PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00059.1.g01030.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 359aa    MW: 39838 Da    PI: 8.3783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00059.1.g01030.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-5261331128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nra
  Zjn_sc00059.1.g01030.1.am.mkhc   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRA 83 
                                     79****************************.99**************95334445667********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t++gyWkatgkd+++ + +g + g++ktLvfy+grap ge+tdWvmheyrl
  Zjn_sc00059.1.g01030.1.am.mkhc  84 TTTGYWKATGKDRRIAC-DGGVYGVRKTLVFYRGRAPGGERTDWVMHEYRL 133
                                     *****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-613155IPR003441NAC domain
PROSITE profilePS5100557.2266156IPR003441NAC domain
PfamPF023654.8E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATTTGYWK ATGKDRRIAC DGGVYGVRKT LVFYRGRAPG  120
GERTDWVMHE YRLCQDLAHG ASNFIGGYAL CRVIKRHEAG LLQGEPPARA KGASTAGGAR  180
GQMSKVPSNS SLGSSEQLST FTSVNSSSPP PPNSFSYGGD VCDMTVTDTT NELPPPPQFA  240
PINWPQMPDM FFVVDDFPDA ESRRPAPFFG ADMGSVSEHE LKWDTLSCAP MNTFPPAAAK  300
TDMLCRQASD GVDDLAAFFF SDENRIRAGN RTGIPGIRRP KERRGSQPCR AARSSPAVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-52116012169NAC domain-containing protein 19
4dul_A9e-52116012169NAC domain-containing protein 19
1ut7_B9e-52116012169NO APICAL MERISTEM PROTEIN
1ut7_A9e-52116012169NO APICAL MERISTEM PROTEIN
1ut4_B9e-52116012169NO APICAL MERISTEM PROTEIN
1ut4_A9e-52116012169NO APICAL MERISTEM PROTEIN
3swp_D9e-52116015172NAC domain-containing protein 19
3swp_C9e-52116015172NAC domain-containing protein 19
3swp_B9e-52116015172NAC domain-containing protein 19
3swp_A9e-52116015172NAC domain-containing protein 19
3swm_D9e-52116015172NAC domain-containing protein 19
3swm_C9e-52116015172NAC domain-containing protein 19
3swm_B9e-52116015172NAC domain-containing protein 19
3swm_A9e-52116015172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7954881e-115JF795488.1 Zea mays NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-143PREDICTED: NAC domain-containing protein 67-like
SwissprotA4VCM03e-69NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A096R9061e-143A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.14e-82NAC domain containing protein 71